Skip to content

FINCHES (First-principle Interactions via CHEmical Specificity) - Python package for predicting chemically-specific molecular interactions for IDRs

License

Notifications You must be signed in to change notification settings

idptools/finches

Repository files navigation

FINCHES

Finches Logo

Current version: 0.1.3 (beta public)

About

FINCHES (First-principle Interactions via CHEmical Specificity) is a software package for computing IDR-associated chemical specificity. The FINCHES paper was published in May 2025 and is available here.

How to use:

Current status of FINCHES software package

FINCHES is currently in a public beta format, which essentially means the code works and runs, but we are actively working on refactoring and restructuring the underlying codebase to improve performance and add new features! As of May 2025 documentation for core FINCHES features is available at https://finches.readthedocs.io/en/stable/.

Documentation

FINCHES documentation for stable features is available at https://finches.readthedocs.io/en/stable/. We encourage you to visit this documentation and raise pull-requests on this GitHub repository if you find issues or errors with the documentation and/or would like additional features documented.

Usage

Once installed (described below), the recommend use is to interact via the Frontend objects. Both CALVADOS and Mpipi-GG have dedicated Frontend objects which implement a number of useful user-facing functions. Briefly, these frontend objects can be accessed as follows

# import the modules
from finches import Mpipi_frontend, CALVADOS_frontend	

# create new instances of the objects; note this 
# constructor can take several parameters
mf = Mpipi_frontend()

# create an analagous CALVADOS frontend object (not use here, but 
# the same functions are usable)
cf = CALVADOS_frontend()

ddx4_ntd = 'MGDEDWEAEINPHMSSYVPIFEKDRYSGENGDNFNRTPASSSEMDDGPSRRDHFMKSGFASGRNFGNRDAGECNKRDNTSTMGGFGVGKSFGNRGFSNSRFEDGDSSGFWRESSNDCEDNPTRNRGFSKRGGYRDGNNSEASGPYRRGGRGSFRGCRGGFGLGSPNNDLDPDECMQRTGGLFGSRRPVLSGTGNGDTSQSRSGSGSERGGYKGLNEEVITGSGKNSWKSEAEGGES'

# generate a homotypic intermap, note this function 
# has a large number of parameters that can be passed
mf.interaction_figure(ddx4_ntd, ddx4_ntd)

# predict and print the homotypic epsilon for this sequence
print(mf.epsilon(ddx4_ntd, ddx4_ntd))

For more detailed description on how to use please see our documentation.

How to cite FINCHES

The core FINCHES publication is: Ginell, G. M., Emenecker, R. J., Lotthammer, J. M., Keeley, A. T., Plassmeyer, S. P., Razo, N., Usher, E. T., Pelham, J. F. & Holehouse, A. S. Sequence-based prediction of intermolecular interactions driven by disordered regions. Science 388, eadq8381 (2025).

However, if you use FINCHES in you work, please consider citing as follows:

  • "... using FINCHES with the Mpipi-parameters (Mpipi-GG) [1,2,3] "

or

  • "...using FINCHES with the CALVADOS parameters [1,4] "

References

[1] Ginell, G. M., Emenecker, R. J., Lotthammer, J. M., Keeley, A. T., Plassmeyer, S. P., Razo, N., Usher, E. T., Pelham, J. F. & Holehouse, A. S. Sequence-based prediction of intermolecular interactions driven by disordered regions. Science 388, eadq8381 (2025).

[2] Joseph, J. A., Reinhardt, A., Aguirre, A., Chew, P. Y., Russell, K. O., Espinosa, J. R., Garaizar, A. & Collepardo-Guevara, R. Physics-driven coarse-grained model for biomolecular phase separation with near-quantitative accuracy. Nat. Comput. Sci. 1, 732–743 (2021).

[3] Lotthammer, J. M., Ginell, G. M., Griffith, D., Emenecker, R. J. & Holehouse, A. S. Direct prediction of intrinsically disordered protein conformational properties from sequence. Nat. Methods 21, 465–476 (2024).

[4] Tesei, G., Schulze, T. K., Crehuet, R. & Lindorff-Larsen, K. Accurate model of liquid-liquid phase behavior of intrinsically disordered proteins from optimization of single-chain properties. Proc. Natl. Acad. Sci. U. S. A. 118, e2111696118 (2021).

Why so many citations?

FINCHES relies on forcefield parameters developed by Joseph et al. & Lotthammer et al, and Tesei et al., as such we strongly encourage folks to cite the papers from which the original forcefields are taken as well as the FINCHES implementation. We note that for the Mpipi parmaters, the defaults used by FINCHES are the Mpipi-GG parameters (developed by Lotthammer et al.), hence the suggestion to cite both the Joseph et al. and the Lotthammer et al. paper. However if this is an issue please ensure the Joseph et al. paper is cited.

Installation

The installation below has been tested in a clean conda environment using Python 3.9+; YMMV in other systems.

This does not use anything different from our usual stack (soursop, mdtraj, numpy, scipy cython etc.) so should probably install easily into your "default" environment. As of May 2025 we generally recommend Python 3.11 or 3.12 for performance reasons.

Dependency notes

  • Numpy: FINCHES will shortly require numpy 2 or higher to run, and we encourage folks to update to a version of numpy above 2.

FINCHES in conda

If creating a new conda environment, the following command works well (note you can run this anywhere as all the files are created in the conda envs directory):

conda create -n finches  python=3.12 -y

Then activate this environment

conda activate finches

From here we can then install the various dependencies

First, install cython, numpy, and pytorch using CONDA.

NB: This is very important because on macOS, we need to ensure we're using consistent Numpy/Pytorch versions from conda OR PyPI, but we cannot mix and match.

Specifically, we recommend the following install instructions (this again can be run anywhere):

# ensure dependencies are from the same ecosystem (conda)
conda install numpy pytorch scipy cython matplotlib jupyter  -c pytorch

# we do this separately and last
conda install mdtraj

# required for integrated disorder prediction; note metapredict is
# only available via pip
pip install metapredict 

Install finches

Next, install finches! This can be done in one of two ways:

Install directly from GitHub

The easiest install is to use pip to install directly from GitHub

pip install git+https://git@github.com/idptools/finches.git

We recommend this route unless you expect to make modifications to the code. This can be run anywhere as the installation will place the package in your conda environment's package store location.

Install from cloned version

Alternatively, you can clone finches and then install a local working version.

Note This SHOULD be executed in a sensible location because this command will clone (copy) the finches Git repo to a local location:

git clone git@github.com:idptools/finches.git

Once cloned, you can move into the finches directory:

cd finches

And then install by running the following command inside that directory (i.e. where pyproject.toml is):

pip install -e .

Once installed, finches will be available in the environment in which you installed it

NB: We use the -e flag because it locally links to the code in this directory. This is useful for two reasons:

  1. If updates are pushed, you just need to run

     git pull
    

    in this directory, and your live version of the code will be updated the next time you use finches. Given that finches are in active development, this is especially useful.

  2. It correctly compiles the associated Cython code, and right now, there's something off with the packaging right now, and the Cython code is not correctly distributed on a non -e install (Alex to fix!).

Check the installation worked

To check this has worked, move back to your home directory:

cd ~

And then run

python -c  "from finches.frontend.mpipi_frontend import Mpipi_frontend; mf = Mpipi_frontend(); print('Success')"

Note this may take a second to run the first time you launch it...

If this print's "success" then you're good to go! If not something is up...

FINCHES in uv

As of July 2025 we (the Holehouse lab) are experimenting with moving from conda to uv, a new high-performance environment and package manager. We will provide explicit instructions for how to set FINCHES up with uv in the 0.1.4 update which may become our recommended installation pipeline going forward.

Demo

Head on over to demo/ directory for some Jupyter notebooks showing the types of things you can do with FINCHES. The documentation

Changelog

Please see changelog.md to track version changes.

Copyright

Copyright (c) 2023-2025, Garrett M. Ginell & Alex S. Holehouse under a CC BY-NC 4.0 license.

Acknowledgements

FINCHES was built by Garrett Ginell and Alex Holehouse.

About

FINCHES (First-principle Interactions via CHEmical Specificity) - Python package for predicting chemically-specific molecular interactions for IDRs

Resources

License

Code of conduct

Contributing

Stars

Watchers

Forks

Packages

No packages published